SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020167 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020167
Domain Number 1 Region: 60-189
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-47
Family Regulator of G-protein signaling, RGS 0.00000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020167   Gene: ENSMLUG00000011119   Transcript: ENSMLUT00000027630
Sequence length 195
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:6464664:6481957:-1 gene:ENSMLUG00000011119 transcript:ENSMLUT00000027630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALNFKKIILTTTFLQESRRL
STEEATRWADSFDVLLSHKYGVAAFLAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKA
HRIFEEFVDVQAPREVNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRS
KMYLDLLSQSQRRLS
Download sequence
Identical sequences G1Q8Y4
ENSMLUP00000020167 ENSMLUP00000010135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]