SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020757 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020757
Domain Number 1 Region: 230-354
Classification Level Classification E-value
Superfamily Cadherin-like 3.27e-33
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 442-564
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-28
Family Cadherin 0.0033
Further Details:      
 
Domain Number 3 Region: 343-446
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-25
Family Cadherin 0.0025
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-21
Family Cadherin 0.0065
Further Details:      
 
Domain Number 5 Region: 585-670
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000004
Family Cadherin 0.003
Further Details:      
 
Domain Number 6 Region: 30-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000957
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020757   Gene: ENSMLUG00000014001   Transcript: ENSMLUT00000014002
Sequence length 807
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429795:4771027:4773447:-1 gene:ENSMLUG00000014001 transcript:ENSMLUT00000014002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGVQRGGLDTQQLLLSLLLFALWEAGSGQVHYSVPEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKGRGDLLEVNLQNGILFVNSRIDREELCGRRAECSIHLEVVVERPLQVFHVE
VEVKDINDNPPVFSLREQKLLISESKPPDSHFPLEGASDADIGENALLTYRLSQNEYFSL
ELPRNSKQTNRLSLTLKKSLDREKTPEISLLLTAADQGKPELTGTVQLFICILDTNDNDP
EFEQPEYKVRLMENAAKETFVIKLNATDLDEGVNGEVTYSLLSVKPNGKPLFTIDKNSGE
VRVNGTLDYEKNKFYEIEVQATDKGNPPMAGHCTVWVEILDANDNAPEITVTSLSLPVPE
ATQPSTVIALISVSDRDSGANGQVICSLTPEVPFKIMSTFKNYYSLVLDSALDREKVSHY
ELVVTARDQGSPSLSATASLSVEVADVNDNAPLFAQPEYTVFVKENNPPGCHIFTVSARD
LDAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDAG
VPPLGSNVTLQVFVLDENDNAPALLTPAPGGPGGAVSELVSLLVGAGHVVAKVRAVDADS
GYNAWLSYELLPAAGGARSPFRVGLYTGEISTTRALDEADSPRQRLLVLVKDHGEPALMA
TATVLLSLVDSGQAPKASSRASLGAQGSGTALVDVNVYLIIAICAVSSLLVLTLILYLAL
RCSTPPTEGACGPGKPVLVCSSAVGSWSYSQQRRQRVCSGEGPPKTDLMAFSPSLPPGPD
KEDGGERQETGSNHLEQVSAIGSLYFE
Download sequence
Identical sequences G1QAM4
ENSMLUP00000020757 ENSMLUP00000020757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]