SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020835 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020835
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily Ferritin-like 1.08e-41
Family Ferritin 0.00000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020835   Gene: ENSMLUG00000024413   Transcript: ENSMLUT00000029333
Sequence length 173
Comment pep:novel scaffold:Myoluc2.0:GL429996:1872052:1872786:-1 gene:ENSMLUG00000024413 transcript:ENSMLUT00000029333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQFRQNYSTEVEASVNRLAKLPLRPHTYLSLGFHFDLEDVALEGLGRFSCELAEKKCE
GAERLLKMQTQRGGRILFQDVLRPPQGEWAKLRTMEAALALERNLNQALVELRALGSTRA
DPHLCDFLENHFQGEKVKRIEKLGHLTHIGRLAGPQAGLAWXHPEALSHALDH
Download sequence
Identical sequences G1QAV2
ENSMLUP00000020835 ENSMLUP00000020835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]