SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021194 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021194
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.31e-71
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021194   Gene: ENSMLUG00000024456   Transcript: ENSMLUT00000031057
Sequence length 174
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:6233103:6239677:1 gene:ENSMLUG00000024456 transcript:ENSMLUT00000031057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFLDVRIGDKDVGRIVIGLFGKVVPKTVDNFVALATGEKGYGYKGSKFHRVIKDFMIQG
GDFTNGDGTGGISIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPSWLDG
KHVVFGKVIDGMTVVHSIELQATDGHDRPLTDCSIVNSGKIDVKTPFVVEVPDW
Download sequence
Identical sequences G1QBW1
ENSMLUP00000021194 ENSMLUP00000021194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]