SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021571 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021571
Domain Number 1 Region: 287-463
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.44e-55
Family SPRY domain 0.000055
Further Details:      
 
Domain Number 2 Region: 7-80
Classification Level Classification E-value
Superfamily RING/U-box 1.19e-21
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000458
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000021571
Domain Number - Region: 132-195
Classification Level Classification E-value
Superfamily t-snare proteins 0.00667
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021571   Gene: ENSMLUG00000027616   Transcript: ENSMLUT00000023212
Sequence length 468
Comment pep:novel scaffold:Myoluc2.0:GL429768:11303463:11304869:1 gene:ENSMLUG00000027616 transcript:ENSMLUT00000023212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEGAVAKLQTEINCPICLDILRDPVTIECGHNFCRSCIERSWADVQDRFPCPVCRHPC
KERHLWSNTQLGRMVDMAKNLQIIVAKVKQQEERRLCEKHNQALTLFCEEDLKLLCPLCT
QPPDHQGHHVRPVEEAASHHRQKLRSYIEPLKKQLADLQKLLATQDRQRSELREKVEKRR
AKLASEYGSVIASIECEQAAVHSRLAAQEKHILQNLTANKAAFSDHISKLRILRKEMAET
SVLSDVKLLMNIKGVLPRCDNLEPPDVYCVKYKREEFSLPPQCSALLQIMQTFREEVTLD
PETAHANLLVSEDKKSVTFVRKKQGVHRNPKGFADDAVVLGSEGFDCGRHYWEVQVDDKP
EWAVGVCKDSLSKERKQPLLRQEDRCWTIQLQDGDYVAQGPVPVTLVLQEMPRGIGIYLD
YEMGHVSFYSLNDMSHIHSFRDTFSEVLKPYFYVGCDPKPLTIRALRD
Download sequence
Identical sequences G1QCY8
ENSMLUP00000021571 ENSMLUP00000021571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]