SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021616 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021616
Domain Number 1 Region: 80-161
Classification Level Classification E-value
Superfamily HMG-box 2.88e-31
Family HMG-box 0.0000319
Further Details:      
 
Domain Number 2 Region: 5-78
Classification Level Classification E-value
Superfamily HMG-box 2.09e-21
Family HMG-box 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021616   Gene: ENSMLUG00000028530   Transcript: ENSMLUT00000029557
Sequence length 188
Comment pep:novel scaffold:Myoluc2.0:GL429968:822685:823251:-1 gene:ENSMLUG00000028530 transcript:ENSMLUT00000029557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSDPKKPQGKMSAYAFFVQTCREEHKKKNPEVPVSFAEFSKCSERWKTMSAKEKSKFD
EMAKADKVHYDQEMKDYGPAKGGKKKKEPNVPKRPTSGFFLFCSEFRPKIKSTNPGISIG
DVARKLGEMWNNLSDSEKQPYNNKAEKLKEKYEKDLANYKSKVKFDGAKGLAKVAQKKVE
EDEEEEEE
Download sequence
Identical sequences G1QD33
ENSMLUP00000021616 ENSMLUP00000021616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]