SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022753 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000022753
Domain Number - Region: 84-152
Classification Level Classification E-value
Superfamily Ferritin-like 0.000578
Family Ferritin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022753   Gene: ENSMLUG00000023625   Transcript: ENSMLUT00000023193
Sequence length 160
Comment pep:novel scaffold:Myoluc2.0:AAPE02066750:630:1112:1 gene:ENSMLUG00000023625 transcript:ENSMLUT00000023193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQIRQNHSTRQRLPPAPRVCGLTYLSGPLLPGPGGHGGRGRFLGAGAGAGGLRVALKE
QTARGRALSRTGGGLPKASGRHSGVMEAALVLENLTWALWSRRPGSVRAAPPLRDFLQSH
FRGEQVELTKKMGDTCLPPQAAAQAGLGEELFHRLTLPHD
Download sequence
Identical sequences G1QGC0
ENSMLUP00000022753 ENSMLUP00000022753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]