SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71279752|ref|YP_267137.1| from Colwellia psychrerythraea 34H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71279752|ref|YP_267137.1|
Domain Number 1 Region: 33-127
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000379
Family Collagen-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71279752|ref|YP_267137.1|
Sequence length 205
Comment hypothetical protein CPS_0379 [Colwellia psychrerythraea 34H]
Sequence
MNMKMLKAALAGLVLSVSGFANAGLILEIGDTGDNLNTAQSLTGGTTQVSGSISTNNDVD
LFSFYWGGGLLDLNVSQDNSALDTQIFLFDSLGFGLFHNDDAPFPNSIIQTALAAGEYFV
GISSWSNDPLSVGGAIFPSDFSGQLTPTGPGGASSLSTWEYDGNSSGAYLLNISSTASQV
PEPSTLAIFALGIMGLASRKFKKQS
Download sequence
Identical sequences Q489X7
gi|71279752|ref|YP_267137.1| 167879.CPS_0379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]