SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50954545|ref|YP_061833.1| from Leifsonia xyli subsp. xyli str. CTCB07

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50954545|ref|YP_061833.1|
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Cgl1923-like 5.49e-71
Family Cgl1923-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50954545|ref|YP_061833.1|
Sequence length 298
Comment hypothetical protein Lxx08270 [Leifsonia xyli subsp. xyli str. CTCB07]
Sequence
MTDANSILGGRILVVAFEGWNDAGEAASGAVKTLKDQLDVVPVAEVDPELYFDFQFNRPV
VADDDGRRRLIWPSAEILGPARPGDTGDARLDATGANAGNIFLLLGTEPSRSWRSFTAEI
MDAALASDIGAIVFLGAMLADVPHTRPISIFASSENAAVRAELGIERSSYEGPVGILSAL
AEGAEDVGIPTISIWASVPHYVHNAPSPKAVLALIDKLEELVNVTIPRGSLVEEATAWEA
GIDALALDDDEMATYIQQLEQARDTVDSPEASGEAIAQEFERYLRRRDGRAGDDPRRG
Download sequence
Identical sequences A0A1E2SMV1 Q6AFW7
gi|50954545|ref|YP_061833.1| 281090.Lxx08270 WP_011185726.1.68452 WP_011185726.1.84704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]