SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_00164 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_00164
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily ENTH/VHS domain 9.35e-32
Family VHS domain 0.00077
Further Details:      
 
Domain Number 2 Region: 248-313
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-21
Family SH3-domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LELT_00164
Sequence length 603
Comment | LELG_00164 | Lodderomyces elongisporus conserved hypothetical protein (604 aa)
Sequence
MAALHTLIDKATAPTLTADNWQFILDVCDQITSDPETETAKSVLLLKTKITSTKDANTIL
RSLSLLVAMAENCGSRMKQEIASKSFTQDCLIKKLLDKKLHITVKLRIVEVVQQLSQSFS
NDPSLKPMKDAHDRIKLEFPQLVSIQQGPTVPAKEERTAQDKNKEDEELQRVLKLSLQEF
ENEQNLKKQYLNNKPLPETNKNFDDGADADDDDNDNNTNGEAPKSHEEQWQHSTTRPESP
PNSDDVETVATVSRVRALYDLISYEEDELSFKKGDVITVIESVYRDWWRGSLPNGKVGIF
PLNYVTPIVNKSPRELKEEIELESKLLNVEHRKIDRLLALLSVEDILQVNEAEVTQLYNE
IITSRNHLSSFIDKYSQRKEELGVLYGQLSSKVKAHHETLQNQHHSYSSPSWPGQNTGGQ
PYNHLPYPTNPSAIPLAGQNTGLYGQQQQQQKQPYHPHQPQQSFYTRLRQDTGYPLAQSN
NGVGYSQNPGSNYSLQTPQPDYTPHPQTSFPLTQQPQSQPQPQPQQQQQQQQQQQQQQQY
SGYSSQPPHEYTQQQQSYQSQPQFHSSQSSHGTLPMPAHSPYPAYGQDIQPQNTSYGFGN
AQT
Download sequence
Identical sequences A5DS28
LELT_00164 XP_001527644.1.59662 36914.A5DS28

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]