SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_00660 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_00660
Domain Number 1 Region: 51-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.92e-22
Family BAR domain 0.052
Further Details:      
 
Domain Number 2 Region: 322-373
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-21
Family SH3-domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LELT_00660
Sequence length 374
Comment | LELG_00660 | Lodderomyces elongisporus hypothetical protein (375 aa)
Sequence
MNSELTKLTNQVCKKWKSVGDVVTKPNCHQVDWKAIKHTPQYLKLKIKYAGVSYTVDEDF
DKLENILKSQSVSLKKLIEQTKQFTSSMVDTIQNAIAVSKCFHDTIDPCSNAHSNVPIFG
DTYDKWANMVKYKQLVQAISIESEIVYLNNGTLKQLELLNNQILKQVFKMIRERRYAALD
CDKLSNEHKTLAEKQSNIGGADQLSSRETSHIFAIGRKLFDAKKKYNYYNALLKKELPSL
ILLIKPIISYATTDLYLLHLNYCYSWIIKLNNIPYKDVPMEKLLRDSETKQVELDAEVRG
LKLFTPMQKDGHTVCTQTNASWSCIALYDYDGLQDDDLTFKRNDTIKIIAKDNDNWWKGE
VKGKVGYFPSNYVF
Download sequence
Identical sequences A5DTH4
LELT_00660 36914.A5DTH4 XP_001528140.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]