SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_00673 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LELT_00673
Domain Number - Region: 322-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00262
Family Classic zinc finger, C2H2 0.048
Further Details:      
 
Domain Number - Region: 23-91
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0214
Family FCH domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LELT_00673
Sequence length 613
Comment | LELG_00673 | Lodderomyces elongisporus hypothetical protein (614 aa)
Sequence
MMDQFGSNDNQYNYSTPRTNRTNTQLASPFSSRVEQQQQQQQQHQHQHQQQQQHHQQQHH
QQQHHQQQHYQQCQQQSLQLQLTFFDAQDSQLEDPDSQASLSVPSQTYYDQATPSITRYV
PSGSTDLANSTRPAHQIQHTQQLFQVPQEHAKAQPPRNDTSLLNQQQIHQPMEDLDTDED
VDPVNNSDWVPRTPANHVIASQFTPTSHISATFPPRSSGHGHRRIQTATLPSQSYHQMFE
NIMRTDQANVPAPKLSPTAEAISTGLLSASASASASGLIPASAPTAVSATTTTTSSSSSS
SPQQKKLRKNRPGHKFGARKRSWVWSWFKQDPSDYNLAICNVCNKSIQRIESDKGSPKKL
SEHLKTHKIGRSDAVAAGRVNLFSEEETGSSLSHQAQVQNQNQHRPQSQHYHLKQQHHQQ
HHQQHHQQQQQQQQQQQQSDLLNILRHRAQDTNDATMRSKVSPKESVAWGDTQPETIAQT
NQQQHLPQLQQHPGSHPHPHPHSHSRVLSDELSGFDSSPYNPIKFHKHIMQFLSEYHLPL
KTLRSKSFLQVIYDLRPQSISDLKELTTLYDSVMEVGRISLIRDDQQHDEDNLIRVDESV
ALLTTMMERGAPK
Download sequence
Identical sequences A5DTI7
36914.A5DTI7 XP_001528153.1.59662 LELT_00673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]