SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_00786 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_00786
Domain Number 1 Region: 69-129,186-351
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.49e-29
Family BAR domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LELT_00786
Sequence length 369
Comment | LELG_00786 | Lodderomyces elongisporus conserved hypothetical protein (370 aa)
Sequence
MSFKFPSFDLKSIQESLPTVDLLRESFSKVDQQFKDSIQPFTNKTQQLLNEQLKQVQQLA
SNVSALPPNIEVSELPKDYLELEVNCDLLLKLYTELIQSNNSTYGQLSYDYPPGNTAFNK
LKDAHIGDSIGAKFNQLKNVSSPQELEKVLLGQASKDAGDDEEEGEEGEDRKAGADGSLV
TIQPTSGGIPRTLFGHLSEILAKQSEELQAKSEELNPLSFVLLQISSTYHEIAAARLVQD
DKIIKGLNNQLVEILNQQFIKVNELRKKVYLTRSQFDQLRSKHEATDPENEELIAKEDEL
VSATELAVIEMKKILKPSKNINLLKIMVQAQKEYFETSAKKLNDLLANLDKVKPEEEDDD
DEEEEEEDE
Download sequence
Identical sequences A5DTV0
XP_001528266.1.59662 36914.A5DTV0 LELT_00786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]