SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_00932 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LELT_00932
Domain Number - Region: 29-126
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0691
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LELT_00932
Sequence length 128
Comment | LELG_00932 | Lodderomyces elongisporus conserved hypothetical protein (129 aa)
Sequence
MSYSKPDKKGFSDVELPSNPNLPSWLITPKEEKAIFERWRKKAFKQCDEYIRRYVECSNL
YRNPVEAMQKCKKVNEASLDCVKQYQKKEYLEIERDLFIKEKQEKKKLYKMRLQELEEER
KKNSQETV
Download sequence
Identical sequences A5DU96
36914.A5DU96 LELT_00932 XP_001528412.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]