SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_01560 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_01560
Domain Number 1 Region: 95-343,371-399
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.84e-25
Family BAR domain 0.077
Further Details:      
 
Domain Number 2 Region: 372-471
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-19
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LELT_01560
Sequence length 1274
Comment | LELG_01560 | Lodderomyces elongisporus conserved hypothetical protein (1275 aa)
Sequence
MTLKHQHHLPVSSDLRTAMKEDQQSLLQLHEAGNLQKQMANTRSNGNEQKIKTPAKAQAQ
AHPEKRTQAPTQAPTQARIQKQTRQPKGQFKLISVSFKEAALDSPSFRASVNHMDNQLNN
IEQWLIALSSSIKKLPRYLQEVESFCNSFLEHLAPGFLQDGFIDQEYTVEALHATILGLK
TIWGRSLNAFSINPQILDEMSEFRKSRVVKYRELRRRFELCQIKYDKYLSIFVSSSKSKD
AVMVVEDAKQLHQVRKEYIHISLDLVVELQDIGSSLDRLLVTLNYKLWEKKWSQFANSAS
SDVLREHWEKVQQVQSWCESYTVAIGKLRHDMTHARLQVEEGANVQFQPSLAPLDYLSSS
INYRSLAEIDETGFEKHGYLFMKTWVERSSKPVWVRRWCFLKNGVFGILVLSPSQTSVEE
SDKIGILLCNVQYSPNEDRRFCFEIKTSELTITLQAETLIELKSWLKVFQNERDRVTAAA
PDSSLFQIASNRFPPILNEFASGVNTAMDRELSNIRIINSAGQAITSSSLTRYVEKFGTI
YERHLYYQIPKVNPPIMTDSTKSATIAYSCVAATVLPTALTANIWGSVNWGLYYLYDSEK
QFAAEKLETVIDYEMVKYQEDHLGLSTIYPSFFPQNLIPLDIQMRALFENVLQPGEYCVM
SFGCIWAPNSRQELAGRCFLTTNHAYLYNQALGFVALYKGLISRLVSVDFVAQRNFDLLK
VYDVDGVIKLKLFLEDVKLIKKKMTYLIDNMASDQPKNLRAVLAAFVEIERETKREEEDQ
KILRKINELSKQLSSKNLSHDRFAFTGDTSSIVPSLNSGALARKIDYTDHYSLLREDIYP
IPPKAVFHAMLGDDSAVFKDETALTKLGYFFKKPWRSSELNGHLYRQATIPVSYGGISSR
LHFEQEIEVMDDNSYYTFTHSISEVEFFIGSPFKLTQRFVIVSISGKRTKLLCFFRVDFK
RYSIWNPLVRIVVNQISIDQFRKVNKMMKYVVKSVGHHGMIVKAIYLYGKLSHTKETETV
EPIPLIRFGMLFSVQLLSAKITKTLKHYARLWLLAVLTAIRYFVKFISTNFVLIGIIVCL
SILNLMLAGKSTINYWTAHKASKLIHDYVSQDPLMLQRAVYSRDIQDYIQSSMQSKNLSN
GVTPFSLFQKSSFTNGITNSTSIARNSYFSPETKTVARNLRNAYQDIGIKRHELLVQLKL
LNKMEKEISMAEYTNWLYAEVQQCDYIQESILSQFSGNNPRGDWTESSTGQSNRGVENIL
EYCQDCRAVLKGLI
Download sequence
Identical sequences A5DW24
36914.A5DW24 XP_001526732.1.59662 LELT_01560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]