SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_02180 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_02180
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-26
Family FCH domain 0.01
Further Details:      
 
Domain Number 2 Region: 351-419
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-19
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 284-355
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000236
Family SH3-domain 0.00075
Further Details:      
 
Weak hits

Sequence:  LELT_02180
Domain Number - Region: 117-157
Classification Level Classification E-value
Superfamily Tropomyosin 0.0523
Family Tropomyosin 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LELT_02180
Sequence length 420
Comment | LELG_02180 | Lodderomyces elongisporus conserved hypothetical protein (421 aa)
Sequence
MNNGKNEYLIKINVANRLKDKYYYQDVPEILDYLQELNEDRVALLNKLLKNACIIERNSL
DRVKDKLHLVDKTIEQNNPKLDVAMFIKHNTVAWAEPQDFYFVPCSIWHDDESLVVKEPE
LTDLKKRLQIASNEYSKYEQSCLDVKQTLEESTERRKLDSGDNITLKFDNNLQNSLRILG
QFIKEDSNRIKNEVEIEIIQNFAGDKDLRYVAPATLKKSRFGFLKGSKKTHHASTNTGDD
YDNSDSQSINTIKTTHTSTSHHNGIFNLRRNKSTATTGSKANVGVATARALYEYTASSAD
ETSISPSDEISVVEEDDGSGWTLVNGSHGQGLVPTTYIEIITRLSGKKPAPPAVAPKRGA
KRIQYVEALYAYAADGDDELTLHVGDKIVLIEDDTDGSGWTEGELNGKRGMFPTSYVKKV
Download sequence
Identical sequences A5DXU3
LELT_02180 36914.A5DXU3 XP_001527351.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]