SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_02474 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LELT_02474
Domain Number - Region: 81-179
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0439
Family FCH domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LELT_02474
Sequence length 333
Comment | LELG_02474 | Lodderomyces elongisporus hypothetical protein (334 aa)
Sequence
MLPYRRPDSPLLSSLISRTASATKLNQLYQDSATRSATATPSAYVTSSLNPARNVPILDS
SSRFQNGNPSIDSLPVISHIDEFRALLDELSEAVTLFKDDEVFTKFEKLTKLNTTIENDI
KELHLHKQRRKSLKQLQNRHKSLDDLQKNTLKKLLSYRSELRKLPRAKTYELKQDKDNDP
NSLKIDVKDIFAYSMKLAKFSKAPVAMGNLSHQIHPNNYIWPAEDSLRRGMLAMSYIQEK
EILENVLGEEKPVSVAKEETSKENSERVSILPSKESGDTSLNGTPHPSNRDHIEIAPTAP
TAPTAVDEDENGYSNEVADLDLDLFDPDAELSD
Download sequence
Identical sequences A5DYN7
LELT_02474 XP_001525916.1.59662 36914.A5DYN7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]