SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_02487 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_02487
Domain Number 1 Region: 384-453
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000407
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 4-86
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000157
Family BAR domain 0.046
Further Details:      
 
Weak hits

Sequence:  LELT_02487
Domain Number - Region: 212-254
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.068
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LELT_02487
Sequence length 454
Comment | LELG_02487 | Lodderomyces elongisporus hypothetical protein (455 aa)
Sequence
MNQKQPPLSEKDQKHIEEYLKEFEVIDTKYNALNDKAVAILPHIMSFLQEFLENIIKLLI
CHQTTVYEKTMETLKYFNIFYGYMNEETIPDYETITTQWEQDITRTRLQLESFLQVVQGK
HTDINEDIDDKDKALKTHKFWVSMTNRLQEKKHVVKPKNQTLGMFNDTVAIDPLDAFVKY
ENPQANQTETYHPRKVIAIEDVVVLKKEVTPPPPLPPRRMSALPILIQTQTHYQSQSQSQ
NQNQDQAYNQLSLPVYPSALNESMESLNLDDDYDDDGASSIISDSSDVSSISSASFSRVT
TRTSSDKQSSTERHLSKIYNTAKNEIKVAPLALSPSLSAEKNVLSWDFPVTVQNSSERPP
MTRAYELSLWQKFFDKLDKSASTERVAKYDFDGRHVGDLSFKQGDTIEIIFDFQRVDSLY
LQDNHNWLIGIIRGDDSANTLSCRIGLVPSNYLV
Download sequence
Identical sequences A5DYQ0
36914.A5DYQ0 LELT_02487 XP_001525929.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]