SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_03158 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_03158
Domain Number 1 Region: 1-179,346-464
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-44
Family FCH domain 0.013
Further Details:      
 
Domain Number 2 Region: 471-687
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-22
Family BCR-homology GTPase activation domain (BH-domain) 0.0046
Further Details:      
 
Domain Number 3 Region: 212-309
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000131
Family DEP domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LELT_03158
Sequence length 890
Comment | LELG_03158 | Lodderomyces elongisporus conserved hypothetical protein (891 aa)
Sequence
MSFADSFWTPDYIQGFQTLFTQLNEGVQENEDHIKLFSKRMELEQLYGSSLQALASDTNL
KPTSKRYFNDDYVSTIKNSYGELKENFAKQGQYHLNVAETIDVTVLQPFEKWSGEHEERV
AYSVSTVNDEYKKLKAQQFQVEKIQKKYFNKCRMVEEFKSQYLEQELQEELNDVAFQKKI
SENNASNGGAEEQEQKQKEPLYEFAHAEIDHHKIEQLLCAMLNSVPRVSHKVAILGTYHN
VSTGSAITQWALDNVAELDKNLEKAEKFGQDLIKNEFIRIVGSMGKSFINSSQFYYQWKP
KAFEIAKVSPGVENEASGNNNNKSFSSFGQFNLDDMKDAIGVGGVDYKDISQYPKLVKDV
ELLNNQYYEKVAELDVTRCRFEELVMDHLTFMQKCELDRLRAIKKVTFDFIASFKYKHNH
LQTVFRDLDLIEETINPINDLKFLVENYATGHFRPQVTLYDNYYESNIKQTFGVDLNVKS
RLDKKVVPILIQCILSHLDNIYPDLKDDEERINIWTQPIHLSEVHKLRLLLNGVDDPVQI
NKILMQTPPIVVTNVLKLYFMELPDSIIPSNFYDVIKLVYINNQDDSQRDSRINGLQNVL
AETFKSNLATLDALLTHLKRLIQIIGSKDKTAAKNLQGGLCNEFGKLVIRPRPATDLFPD
SNHRQNMNDKHAVMIIQDLFRYKDQIFNELKRKSSKAKSNGSSSSSSSSSSILHRASSGS
SSASASVSREASATSSRQRTATGDLASTTSVHAHQPLTPGENLAAKSKSRLESRLKNAVK
QRDLASKPLESKDDGDVDHNNNNNDNDDVEKKPRKEEEEEEEQKQEVKKKKEDNKKDKPL
PDPTYVEAPSTPPQPVSSMSTPSKSPISLKRSTSPKKKRLSSMLLDEMGN
Download sequence
Identical sequences A5E0M1
LELT_03158 XP_001525230.1.59662 36914.A5E0M1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]