SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_03566 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_03566
Domain Number 1 Region: 20-83,113-265
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.77e-51
Family BAR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LELT_03566
Sequence length 293
Comment | LELG_03566 | Lodderomyces elongisporus conserved hypothetical protein (294 aa)
Sequence
MSWIGIKKAVNRAGTQLMVKTGQLEQTIDKEFEYEEKRFKTMETNLIQLQKRLRTYLDSL
KLLTTSQVNIAELLNSFYGNEANTNTMKPRIDESHHFPPPPNSLPSHHHYLNLASEYYQT
LKLLNDECVNELERPYNQTVLNPIARFNSYYVEVNEAIKKRNNKLLDYDAMRNKVKKLVD
AQHSDHDDFENKLRESNEELKDLEDKFVEINNQLKDEIPKLVNMRVAFFDPSFESFVKIQ
LRFFNENYQRLNELQTKLDAQTKQDYVEGKLESKIDDVLNKMRMLDITGSTGF
Download sequence
Identical sequences A5E1S9
LELT_03566 XP_001525638.1.59662 36914.A5E1S9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]