SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_03945 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LELT_03945
Domain Number - Region: 205-259
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00785
Family Phase 1 flagellin 0.047
Further Details:      
 
Domain Number - Region: 356-491
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0889
Family IMD domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) LELT_03945
Sequence length 519
Comment | LELG_03945 | Lodderomyces elongisporus predicted protein (520 aa)
Sequence
MPFFNKCFQNVFAKDSKPFYFSKKLGSQLPVQESIIPEEAERFLIAEGVRRSTIAGEKRP
CKRGDVFKVSLLFQGLRTKFKSFNPKMFQWMKWLQQVNDTDFIQSFVSKQHSVVRIGESA
FTSADKKYLIYRVSKEHFEEIESEVANSTTLWEEDLVLPPYLHLFSMKVYDEDRYYTISP
VLDNKADREYPSEQDTNSANYTNSANYTNNTNYTNNTNNTNNTNNTNNTNNTNNTNNTNN
TNNTNNTNDANYISDFISTRNTCYTNEALSTAHCSRTSWQHIYCIDQDSIMGTIGIPMLA
EERENLLLKLSQQTKHLVAQKKTNYKLVIGIVFNEKIRPKIQVWFDAHHRIYKGEGRIKT
LFRFGKAKARTPEEYASWLLESLDQHIEVIEGELHPENFEITTPPLSTSLTCFLNSIKAS
FKKVFKLFLNLSKALRIAELGQSLINAKNKKLKKPEKLKKPKKRKKRKKRKKKTRKKKGL
RSKLKDTLILMLFQMLFILLILMLFLKLFLMLPLLLLHG
Download sequence
Identical sequences A5E2V8
XP_001524913.1.59662 36914.A5E2V8 LELT_03945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]