SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_03962 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  LELT_03962
Domain Number - Region: 65-197
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0178
Family IMD domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LELT_03962
Sequence length 229
Comment | LELG_03962 | Lodderomyces elongisporus predicted protein (230 aa)
Sequence
MGTIGIPMLAEERENLLLKLSQQTKHLVAQKKTNYKLVIGIVFNEKIRPKIQVWFDAHHR
IYKGEGRIKTLFRFGKAKARTPEEYASWLLESLDQHIEVIEGELHPENFEITTPPLSISL
TCFLNSIKASFKKVFKLFLNLSKALRIAELGQSLINAKNKKLKKPEKLKKPKKRKKRKKR
KKKTRKKKGLRPKLKDTLILMLFQMLFILLILMLFLKLFLMLPLLLLHG
Download sequence
Identical sequences A5E2X5
XP_001524930.1.59662 LELT_03962 36914.A5E2X5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]