SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_04073 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_04073
Domain Number 1 Region: 19-245
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-58
Family BAR domain 0.014
Further Details:      
 
Domain Number 2 Region: 397-462
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-24
Family SH3-domain 0.00035
Further Details:      
 
Weak hits

Sequence:  LELT_04073
Domain Number - Region: 332-398
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LELT_04073
Sequence length 463
Comment | LELG_04073 | Lodderomyces elongisporus reduced viability upon starvation protein 167 (464 aa)
Sequence
MSFKGIKKSIVRAPQTFRQKMNMGEITHDPVYQDAERRFQEIEIETKKLSDESKKYFQAI
TGLLDDQIEFSKAIEEIYKPISGKLSDPNATVPEDNPDGIMAAEQYRELVKTLKETLKPD
LELIEKRIVEPAQELLKVIAAIRKMATKRDHKQIDLDRHKRTYTKYEQKKERTAKDEEKM
YSAQAEVEIAQQEFDYYNEMMKNELPVLFQKQSEFISPLFVSFYYMQLNIFYQMYSTMEE
MKIPYFNLSDDILEAYNLKKGNIEEQTDAIGITHFKVGHAKSKLEMAKRHHASVTSPTLS
ATSTGTELPAYSGGAPVGYNPDYKGAELTSPTSTGLYGYQPQAGYQSPQTTYGQQLPPPQ
QQQPQPQQQQTGYGQPTAAGAAAPAAYQQPNATGSAPPAYMNTPPASSSETCIAMYDYTA
QAQGDLTFPAGATIEIINKDDPGWWMGRYNGVQGVFPSNYVKQ
Download sequence
Identical sequences A5E386
LELT_04073 XP_001525041.1.59662 36914.A5E386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]