SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_04316 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_04316
Domain Number 1 Region: 18-295
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-45
Family FCH domain 0.019
Further Details:      
 
Domain Number 2 Region: 791-865
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000643
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) LELT_04316
Sequence length 866
Comment | LELG_04316 | Lodderomyces elongisporus conserved hypothetical protein (867 aa)
Sequence
MRTTAAEVTTNSVEGYVEFVNNFWGSSPEQSFEIISIRIKDSIKTLYEVINFYQEKISIE
KDYIKRLEKLQAKCPLGTHETGSLKRSLDKFHLENDTMIDHNVKFVKSTQDANLEKLQHF
TQLYIQKVDKLRHHMSKVISRRANTLKELNVHKNKYQEECGLMKSLKLQLQTTWGKELEK
NQLKYNKLSSSIAQTRNNYQYSINAFKEINDIYKRDWSISVNDFYKLEIERVQLIKINCF
NYCNNIATLCVDVDQSIDLARSSFAAVQPQPDVQEFSNNYGTGNKIYNDPEFVEYMTGTE
EPSIGYTILGLRNPNHDEILTRTYSNFSQRQQVGKQQLPPKNLQQPPRNGRDNGESIMFN
PIDDFTLKAQAARPSTEKMIANGSNNTNTNTTTSNNNHSNGVGRGSPPKSPFYHHITSPL
KDLPKVDLQFTNPLENEKNFNERNHFVTPTKNTIFETSPYKQRTAIPDLSPTKQINATMT
TNATTPSNPTMTPIPIPLPISSPTQTAKTKPIEQHIPATRQTLSPPKNSHSPARKPPIDL
LSHKTQSTSSSVPDNDVFSKDERLSNSGGTSSNYSSERNWASPRRREKQLQQMQEQITRR
ATNEFGRRSQNSRNDAIDQQLINAKTKVPIVNDFSIDFIAKALEDLNAGGNGDVNQFRRS
IRSNGNGLNAGNHERNSERNYERGHERDRESIVTSTYSRRPKSDYIDDHNEVAQRYESIS
FRRPKSMVDIGGSDNGVNNVNESFANKRASPDVFTTKPQQYPYAQKQNRYYQTPNNSPLK
SKTVELKNVKPTIKITPVNQRPYVSTATARYTFKPQEEGELYFRKGWQMFIIHKQEDNWF
VCELGPNCDDCNGMIGLVPGNYIVEH
Download sequence
Identical sequences A5E3X8
LELT_04316 36914.A5E3X8 XP_001524345.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]