SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_05644 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_05644
Domain Number 1 Region: 33-92,129-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.56e-38
Family BAR domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LELT_05644
Sequence length 345
Comment | LELG_05644 | Lodderomyces elongisporus conserved hypothetical protein (346 aa)
Sequence
MSFNFANFTKDLKSFGDRLTTDFNNEVLPLAQRTQRMVQEKIGKVNADDISQLPTEYIAL
AEKCNSIEKLYKNVLKITTNYENESYDYPLNLQESFTDFSQNITRRFSNLSKATTTAEAQ
AALIKPDETFKPPKTLYHALSRATDASVLTDGSGTGADEDYSQLASVAAGTTKSESSDPL
IKGLDLYSSSLKKIADARIGQDQLIKQKFNLPLQTTLRSLISQSNNIQRKVEQKRIDYDM
TRYNLTNCNNPAKESKLRVDMENAEDEFANTVEDAINIMQNVVENAKPLQEFLNLIQAQL
AYHKLASELLGSMVGDFENLIEEQNKLSAGSGHNQTGKESGEFEL
Download sequence
Identical sequences A5E7Q5
XP_001523098.1.59662 LELT_05644 36914.A5E7Q5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]