SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_05730 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_05730
Domain Number 1 Region: 318-439
Classification Level Classification E-value
Superfamily PX domain 1.31e-28
Family PX domain 0.0019
Further Details:      
 
Weak hits

Sequence:  LELT_05730
Domain Number - Region: 513-715
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0022
Family BAR domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LELT_05730
Sequence length 725
Comment | LELG_05730 | Lodderomyces elongisporus hypothetical protein (726 aa)
Sequence
MDDLTKSVWDDEESTSIGDGRNTTLQYDQVNEPHTSTFNPASSSSSVTAPLISTFNSFSI
DDPFANPFSDDKPQEEVEEEEEEKQEGFREQKQEQGQEKHNENNELEGGEQDDDFFKAGK
VNGASDNGLYSPRKHHLQSQILSELTEGSDSFDLEQSLTKPTASKNILKSDQLFSDKDSP
IKLSSSDQSSISSPSSVGPINLKKFKAKRPRRFDSKTNVQHLKGELENVNSNLLGPLTFE
NKQKRDKEEEKDVGNQGAQKEPTELTTEAIGNQMGTIHEELQGNKKNSNNSPSKQKTTPK
NTTKNTETNSYAEAPLKNDNQLEITVGDPMKVGDITTAHIMYTIKTRNKNLDSPNFPQIK
EVSVQRRYSDFRWLFHQLQANHPGRIIPPPPAKQSLIGRFNEKIIEHRRLSLEKMLNHIN
TKPLLCNDPDFVSFLTNENEGHAFGDASLDESAIQDGHSSVSSSFTTPTSTTTTTTTTTT
ATAAANAANAAASAAFASTGFMSSLFSLSTKYTEPDSYFTKKKQYFDDLEYNLKQLLKTL
ELIGTQRLDLLNIWEEIAITMEELAAVEITKSTSDLFNAFSQVQYHIKDNIERLNLSDQL
TMGFTVEEYLRLIDAINYTFKTRIKIFELLSSLNAQVDKLSRKLSLLPEKSFELERMKER
QSSLQKDFNEISNTIKLELDEFEMTRIDDFRNNVEIYIENAIESQKEAIEVYETFYSRYI
AVDNE
Download sequence
Identical sequences A5E7Z1
LELT_05730 36914.A5E7Z1 XP_001523184.1.59662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]