SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for LELT_05747 from Lodderomyces elongisporus NRRL YB-4239

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  LELT_05747
Domain Number 1 Region: 78-292
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.74e-51
Family BAR domain 0.0019
Further Details:      
 
Weak hits

Sequence:  LELT_05747
Domain Number - Region: 10-41
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 0.00916
Family Uracil-DNA glycosylase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) LELT_05747
Sequence length 320
Comment | LELG_05747 | Lodderomyces elongisporus reduced viability upon starvation protein 161 (321 aa)
Sequence
MPLIPKKKNTMHQKQAILTPTHPSPVSPPRAFHYSHHFNTFTTTRPVFPISTKKKNMSWT
GFKKAVTRAGGSVTVKSVDKTMDKDFDTEERRYKTLKSAGETLQKASKGYLDHIRAVTRS
QVVIAEIVSNLYEESKQGQSAYTALGTYYLQCVQEFDEETVKQLDGPFRETVLDPIAKFA
HYFVEIDEAIKKRAHKKTDFEQCKSRVRRLIDKPAKDAGKLPKAEKELAMAKEIYENLNK
QLKDELPQLIALRVPFYDPSFESLVKIQLRFCTEGYSRLAQIQQYMDPASRDEYANGILD
GRIDDLLGQMQTLTITSLGK
Download sequence
Identical sequences A5E808
LELT_05747 XP_001523201.1.59662 36914.A5E808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]