SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389870544|ref|YP_006377963.1| from Advenella kashmirensis WT001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389870544|ref|YP_006377963.1|
Domain Number 1 Region: 21-182
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.89e-23
Family AD-003 protein-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389870544|ref|YP_006377963.1|
Sequence length 200
Comment SAM-dependent methyltransferase [Advenella kashmirensis WT001]
Sequence
MVEIAGSKGYAEKAQRFAADYESVTFEKVHNPVRGFYPGAPAKVLDIGAGTGRDAAALAA
LGYQVDAVEPTAAMREQGDLHHADANINWIADSLPELALVRASAKRYDLILLTAVWMHLR
EEERLPAMQHCAALLGRNGIMSMSLRHGPVPAERHMFDIPDEETIALAHTCGLQLLYQKS
YKNDTLGRNDISWSYAVFRK
Download sequence
Identical sequences I3U7J3
gi|389870544|ref|YP_006377963.1| WP_014749072.1.62074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]