SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389870627|ref|YP_006378046.1| from Advenella kashmirensis WT001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389870627|ref|YP_006378046.1|
Domain Number 1 Region: 38-171
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000301
Family BC2162-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389870627|ref|YP_006378046.1|
Sequence length 273
Comment hypothetical protein TKWG_02080 [Advenella kashmirensis WT001]
Sequence
MTLIPEIKPQQSLELLKELHILTREGKINQDTRRKLKQVYHLYQFIEPLMQTVLDQGQGL
SLVDHGAGKSYLGFILYDLFLKEHVSATVYGIESRAELVRKSEDLARRLGFDGMQFKDMT
VEQSIASAELPEKIDIVTALHACNTATDDAIRFALARDARFIVLVPCCQAEVAAALRATK
GNTLGKTPLSELWRHPLHTREFGSQITNVLRCLQLEARGYQVTVTELVGWEHSMKNELII
AKKTGGFKKSARERQLAILKECHLEALQERFAY
Download sequence
Identical sequences I3U7S6
gi|389870627|ref|YP_006378046.1| WP_014749155.1.62074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]