SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389872028|ref|YP_006379447.1| from Advenella kashmirensis WT001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389872028|ref|YP_006379447.1|
Domain Number 1 Region: 9-281
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.48e-88
Family LPG1296-like 0.00000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389872028|ref|YP_006379447.1|
Sequence length 285
Comment hypothetical protein TKWG_11250 [Advenella kashmirensis WT001]
Sequence
MFSYRHAFHAGNHADVLKHAVLLHILEYYNRKDAPYWVIDTHAGAGVYDLTDAWAEKTAE
FRDGIERLWHLPQLPVLLADYIDHVRQLNDQGGLSVYPGSPWIALQLMRPADRLRLFELH
PTEITHLDENIQMQSRDVARQVSVFEKDGFTGLLSQLPPAPRRGIILIDPSYEDKNDYRH
TLTAVREGLKKFATGCFAVWYPLVRRKEVHDMQKQLEKISDASWVHVRLAVKRPPENGYG
LYGSAMFVVNPPYTLVSALREAMPVLEKQLAQDDQAQFSLTHQDK
Download sequence
Identical sequences I3UBS7
WP_014750556.1.62074 gi|389872028|ref|YP_006379447.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]