SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389872309|ref|YP_006379728.1| from Advenella kashmirensis WT001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389872309|ref|YP_006379728.1|
Domain Number 1 Region: 1-183
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.33e-31
Family UbiE/COQ5-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389872309|ref|YP_006379728.1|
Sequence length 212
Comment putative methyltransferase [Advenella kashmirensis WT001]
Sequence
MKDYYGARANEYDRIYLKPERQADLQKLQMWLPPMFAGRSVLEIACGTGYWTQFYAPLAK
RVVALDAAQETLDIAAGRITANNVQLLRGDAYELPVFDASFDVAFAGFWWSHIPQEQIQE
FLTGLHRVLEPGARVVFLDNRFVSSSSTPIAERDSAGNTYQIRTLDDGSTHRVLKNFPTR
EQLLAAVSWYSASCNYLEWEYFWALEYTLHLP
Download sequence
Identical sequences I3UCK8
WP_014750837.1.62074 gi|389872309|ref|YP_006379728.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]