SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SS1T_12852 from Sclerotinia sclerotiorum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SS1T_12852
Domain Number 1 Region: 126-310
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-38
Family Hypothetical protein AT3g04780/F7O18 27 0.00054
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.1e-31
Family Thioltransferase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SS1T_12852
Sequence length 327
Comment | SS1G_12852 | Sclerotinia sclerotiorum hypothetical protein similar to thioredoxin I (328 aa)
Sequence
MSKTVVIKSPAEFSNLLKTSKIVVTDFYADWCGPCKAIAPIYEQLSAQLSRPNRITFTKV
NVDNQTEIASTYGVTAMPTFIIFRKGKQVEKVQGADPNRLQDIVKKLAAEADKSDDSSSG
FASGSGDWRTGALPKGYSDVTDQVDIKGLELLNADSEFGGVRTLVDTNKPSALSKGKGAD
SKAKDWVVSDTDEQLMLFVPFQSTLKVHTVQITSLPSATDDEDDEEVPMRPKTIQIYTNR
AHIVGFDEADDLPSTQTITLEANDWDSTGTATLSLRFVKFQNVTSLVFFIVDGDGDGEKV
RLDRIRIIGETGEKRDPGKLEKIDDGH
Download sequence
Identical sequences A0A1D9PUR9 A7F5H4
665079.A7F5H4 XP_001586274.1.14510 SS1T_12852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]