SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR000477-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SMAR000477-PA
Domain Number - Region: 6-23
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00271
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 67-122
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.034
Family P-domain of calnexin/calreticulin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR000477-PA
Sequence length 123
Comment pep:novel scaffold:Smar1:JH430052:522:1393:1 gene:SMAR000477 transcript:SMAR000477-RA description:""
Sequence
KQDKLAVCNCADNYHGNRCQFEALTKPDEKPSNLGWVAAVVLIVILAIVAGTILYLKKYR
NPNVTENAPIMTIDNPMYETPTEALEYDSFNYKDPDTTIPSGLDETDGKETDGAGIVNPL
YSK
Download sequence
Identical sequences T1IHZ5
SMAR000477-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]