SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR007054-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR007054-PA
Domain Number 1 Region: 17-215
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-58
Family Calnexin/calreticulin 0.0000701
Further Details:      
 
Domain Number 2 Region: 200-313
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.54e-44
Family P-domain of calnexin/calreticulin 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR007054-PA
Sequence length 418
Comment pep:novel scaffold:Smar1:JH431735:102420:104917:-1 gene:SMAR007054 transcript:SMAR007054-RA description:""
Sequence
MRAVNVGLCLLFASLIQAKVYFREEFDDSWESRWVASTHKGSEAGKFVLSHGKFYGDAEK
DKGIQTSQDARFYALSSKFQPFSNDGKSLVIQFTVKHEQNIDCGGGYAKIFDCSLDQTDM
HGDSAYQIMFGPDICGPGTKKVHVIFNYKGKNLLINKDIRCKDDEYTHLYTLVLKPDNTY
VVKIDNEKVESGELEADWSFLEPKKIKDPSASKPDDWDDRAKIDDPNDTKPEDWEKPEHI
PDPDAVKPEDWDDEMDGEWEPPMIDNPEYKGDWKPKQIDNPLYKGAWVHPEIDNPDYVAE
ENLYRYKEFCVFGFDLWQVKSGTIFDNILITDDEDAAKQIGEETWGVTKVAEKKMKDKID
EDERKKRDEEEKSKKSEPKDEEEEEEDEDEDDDKDDKSKEKEDKEGGEDKHDHEHDEF
Download sequence
Identical sequences T1J0K3
SMAR007054-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]