SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR000319-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR000319-PA
Domain Number 1 Region: 195-269
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000392
Family DEATH domain, DD 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR000319-PA
Sequence length 276
Comment pep:novel scaffold:Smar1:JH429910:166138:168164:-1 gene:SMAR000319 transcript:SMAR000319-RA description:""
Sequence
MRAHRSAHVIEMASGNDANNVIDSDKDESLVPDAVPTAPAEEIVPSNNDSSGLIQSSHSR
KIPELPSEGIIRSDPIPKSHTQDLPGDEFNKGFQQFGGFPPGLFSSKFKNFNPGSKEPSL
SSANFMNQTAVGGANVTAIQIGHANNLHFGNNITINHGLTKTSGYKRTKNEKPKKSTVPI
DILTSKVIVSEDVMLIVKHGDLGYKWKDFGMHLSLTNGALETVEYEHRQYGLNELVFQTL
IKWKEKVGDSATVGKLANALDVIGREDLALSLLNSE
Download sequence
Identical sequences T1IHK4
SMAR000319-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]