SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR000960-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR000960-PA
Domain Number 1 Region: 503-754
Classification Level Classification E-value
Superfamily NHL repeat 9.68e-30
Family NHL repeat 0.001
Further Details:      
 
Domain Number 2 Region: 399-484
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000203
Family Filamin repeat (rod domain) 0.002
Further Details:      
 
Domain Number 3 Region: 110-179
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000854
Family RING finger domain, C3HC4 0.0067
Further Details:      
 
Domain Number 4 Region: 184-216
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000618
Family B-box zinc-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR000960-PA
Sequence length 755
Comment pep:novel scaffold:Smar1:JH430236:18581:25654:1 gene:SMAR000960 transcript:SMAR000960-RA description:""
Sequence
MEADGRVTADATTMALHRTGRFFMSGMRFDVTVYLKRQKFGRVENERKMTAMGKTKSTSK
KLTLKLTKSGILIQCRARLGAKMTTSSTLVETVSINFEDFNESMYDGSEHTPKLLPCSHT
VCRQCLERIVAVATLQSREAGTFRCPICRETIVLPRGGVNALPPSFLVNQLLDLMLRQRR
EVIPKCSQHPAQELLFCETCDTVFCTQCTTGFHGNGGVGEHTVIPFSIAIKRMSEILLYK
AHECAGKLSRAAETVGEEVQKLDRNAEAAFELVNKSFQDVLTLVEKRRMEVLAVVKKTRD
EKKSILQEQLQLIQSEKEKVQEECNGLQYQVEVRNITKKISELNEKLDTVGSLNEPRENA
HILYEWTHNNALSDIQLALSQIGRVRISKTFPALCTAQVHSATMHLQTKTVVTTVDYHGH
TRTDGGDPVVAELRQESGDLCPSYVKDNQDGTYDISYTTPNSGSFCLHVTVFERPIKDSP
FKFEASIHINPIFQFGNRGSGTHQFNQPVGVAVDANRIYVTDTGNSRIKVLSLSGQFLDD
IETEGLEERGGIGLCLTAKDTLLVVNWRSKSVTEISEERGVVRHFVYDGFAEPIDICVNS
RSDILVADNGLSCVFMLDSKGKLLRKIGSKGSASGQLGIISSVAIGRDDDVLVGDSRIQV
FSLNGEFIREFFPETKVRGGKFGGIAYDGKDFVLATRTEKNMTGIHVYNYEGLLQFVIDS
HEAKLRRPAGLAVTEDGRVIVVDLGNDCVKMYRYK
Download sequence
Identical sequences T1IJA1
SMAR000960-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]