SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR001127-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR001127-PA
Domain Number 1 Region: 160-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.02e-77
Family Nuclear receptor ligand-binding domain 0.0000000305
Further Details:      
 
Domain Number 2 Region: 108-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.97e-30
Family Nuclear receptor 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR001127-PA
Sequence length 426
Comment pep:novel scaffold:Smar1:JH430339:42411:47411:1 gene:SMAR001127 transcript:SMAR001127-RA description:""
Sequence
MMKKDKPMMSVAAIIQGAQANPMWNTVGGLIENAYNMSSANPHSPIEHKPDAATLLSSSN
YSPGGGPNSPNLSQQSFTIGHSGFVSGSQSNGKSPSYPPNHPLSGSKHLCSICGDRASGK
HYGVYSCEGCKGFFKRTVRKDLSYACREDRLCVIDKRQRNRCQYCRYQKCLSMGMKREAV
QEERQRNREKNENEVESTSSLHNDMPLERILEAEMRVEPKPEQISSDENSIPDFCNAASK
QLHQLVDWAKHIPHFTELPISDQVLLLRAGWNELLIASFSHRSVHVRDSIVLATGLQVHR
NHAHSAGVGTIFDRVLTELVAKMREMKMDHTELGCLRAIILFNPAKGLRSTQAIESLREK
VYAALEEYCKQQYPDEPGRFAKLLLRLPSVRSIGLKCLEHLFFFKLIGDTPIDTFLTEML
ESPIDT
Download sequence
Identical sequences T1IJQ4
SMAR001127-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]