SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR001676-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR001676-PA
Domain Number 1 Region: 105-165
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000123
Family Nuclear receptor ligand-binding domain 0.00056
Further Details:      
 
Domain Number 2 Region: 45-69
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000194
Family Nuclear receptor 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR001676-PA
Sequence length 220
Comment pep:novel scaffold:Smar1:JH430736:2017:17083:-1 gene:SMAR001676 transcript:SMAR001676-RA description:""
Sequence
MSSANPHSPIKHKPVLSSTNYSAEGGPNSPDPTYPPNHPLSGSKHLCSICGDRASGKHYG
VYSCNKRTVCVQKGQVVRYRQTTEKSMSILSVPEMFIDGQEKKRLMPLEGILEAEMRIEP
KPEQISSDENSIPDFCNAASKQLHQLVDWAKHIPYFTEFPISDQVETNFSSRLYLIVRFM
FAIASFWLLGCRYTVTTLTMQAWRPFLAWFSRNFVAKMKN
Download sequence
Identical sequences T1IL57
SMAR001676-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]