SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR002937-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR002937-PA
Domain Number 1 Region: 110-411
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.17e-27
Family PA1517-like 0.075
Further Details:      
 
Domain Number 2 Region: 29-97
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.000000000000011
Family Tachycitin 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR002937-PA
Sequence length 500
Comment pep:novel scaffold:Smar1:JH431263:21808:24577:-1 gene:SMAR002937 transcript:SMAR002937-RA description:""
Sequence
MSLDRFRLLLAALLVILTVDKSTSQPNITRPGRFICPYTNGLFADPALCRRFYSCTNYEA
FLQSCPPGLFFDDIKKFCTFKNEVTCGPVDYETTPTPTVDPNDPYNVKKCDLSACNLPDC
FCSVDGTRIPGGLSREEVPQMIMLMFSGAVNLLNYPQYNAVLGRNRTNPNGCPIGATFFM
SHEYTNYHYVSKLHSEGHEIAVNSISRSKPESLWYRGSYENWTLEMVGMREILIRYAEIP
KEEILGVRAPYLKTGGNEQFDMLNDYGFLYDSSMAAPPSKIPLWPFSMEYKIPFKCKSEN
CPQHSYPGIWEIPLNTLHTEDGLGGNCPMMDQCVFPHADEETIYEWLLENFDRHYRKNRA
PLALNMQSNWFLTEAAVNGLKRFVNDMLNRDDVWFVTATQALHWLVDPAPLTNINKFDPW
KCEVPRAPSCNLPRTCVLPFSAPGIVPDLRYMQTCVRCPKKYPWIGNVGGEVKTTQDFYE
PEITRGPPKEALDEEFPEEE
Download sequence
Identical sequences T1IPI5
SMAR002937-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]