SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR002947-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR002947-PA
Domain Number 1 Region: 118-149
Classification Level Classification E-value
Superfamily WW domain 0.000000018
Family WW domain 0.0023
Further Details:      
 
Domain Number 2 Region: 9-54
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000803
Family HkH motif-containing C2H2 finger 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SMAR002947-PA
Sequence length 285
Comment pep:novel scaffold:Smar1:JH431263:70701:72056:1 gene:SMAR002947 transcript:SMAR002947-RA description:""
Sequence
MADYWKSIPRKFCDFCKCWLTDNKPSVEFHERGRKHQNNVQKKIGELRRKGQKMAQEEKN
TDRMMKQMEQNAMKAFSKDIVTNPDLSAKSGNFAAASVGSFSSYSSGGFSGASFKVKVWF
QEKSEDGTKYYWNCETGASQWEIPEEGYVTLREQEEPENNLLNLGTLKPQLKIPEELIPE
IEANKQVPQPEPPPPPVTFNKNPYGSWVTVSTSRPKQIDFQLPKLEERVEIVIPEVYEEP
QMKFEEKVMPNLNIKTSNSQVGFKKRKINDNFKRNIRQKLEDEET
Download sequence
Identical sequences T1IPJ5
SMAR002947-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]