SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR003728-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR003728-PA
Domain Number 1 Region: 589-671
Classification Level Classification E-value
Superfamily DEATH domain 5e-16
Family DEATH domain, DD 0.0039
Further Details:      
 
Weak hits

Sequence:  SMAR003728-PA
Domain Number - Region: 504-565,592-620
Classification Level Classification E-value
Superfamily DEATH domain 0.0114
Family DEATH domain, DD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR003728-PA
Sequence length 681
Comment pep:novel scaffold:Smar1:AFFK01018673:6923:10641:-1 gene:SMAR003728 transcript:SMAR003728-RA description:""
Sequence
MMGVKIPLRIEEENEEVARPVERMQSSKTAEDNVKGEEEIISKGDVIQAKAMNTETLSTD
LKRAHFNIESSRQEISHASSNQKTESLENVKFNVIDDPKMVKILSMKDMMEIPLAGETSN
EIINPGAKSATPKLIYRKASLAIGKQLNDNTPEVLFGLKPPVIINKSSSDTDVLKKIADQ
ESQDIKADVSTQEDENSIESTLSTGFIASVKTEGSKISTQSPVPTENKQQEILPDQVSPK
QSKGKLEVKTERINRSKKKKLSRQTAGFETEQDVPRNHRSSSLPPLPYTLKDYRQLQLDI
QLGGLGPILQKYQRQANYAQQVMDRNRKLLEAKLEKSKTTFAQVMQEASDPSKDARQRGL
NYAKNIKKPPKLDKEENKEPTSNRQVKLPPLRPGNLQSEGAAKVVYLETVEEEEPTGVGS
TVKTRPFAMDSLMENVEKLRERHAKEREIVDQLFTDKAMVYIRTEMDDYVILKQQFCGSL
SNFSNAGAILHESIKIFTQIIDSSRTVSSIKTLEQLLLVLEYRDELSPTNVTILKKWINA
MKLPTGLSIVEQYEKLHDICSYEPKCDICHTLMDQSLNFQDEIESHIDDLDDAFDEISHL
LGRSWKDFARKCDLSQYEIDDITDNEKRLIDRAYWVFTCWKERAGNSANVVKLIEVLEKC
QRKDLADKLRSFNSVEMEKTS
Download sequence
Identical sequences T1IRM9
SMAR003728-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]