SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR004928-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR004928-PA
Domain Number 1 Region: 56-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.26e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 127-256
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.96e-16
Family Glutathione S-transferase (GST), C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR004928-PA
Sequence length 279
Comment pep:novel scaffold:Smar1:JH431564:24362:26292:1 gene:SMAR004928 transcript:SMAR004928-RA description:""
Sequence
MALALCRSIGKGSHRHSEVLLKYRSFVILSHLRTSSKMSEKSLSKGSECPALEKDKIRLY
SMRFCPYVKRVRLVLAEKNVQFETVNINLTEKPEWYLKRFPDGKVPVLEQNDKQVFESLI
ISDYLDEFCPGEKLHPIDPYRKAADQYLLSKFSKVSDNWGRAVHKPAEAKEAFQDVILGL
EFFETELAKRRSKFFGGSRPQMLDLMIWPWFELLMSGEHFLGQGYEFEIVLANNKFPVLC
SWVKSMSGHPSIKKLMNIENQNNFAESVKAGNRNYDVGL
Download sequence
Identical sequences T1IUU7
SMAR004928-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]