SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR005010-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR005010-PA
Domain Number 1 Region: 761-909
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.26e-36
Family Toll/Interleukin receptor TIR domain 0.00011
Further Details:      
 
Domain Number 2 Region: 135-510
Classification Level Classification E-value
Superfamily L domain-like 1.11e-31
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 3 Region: 568-683
Classification Level Classification E-value
Superfamily L domain-like 1.87e-20
Family Ngr ectodomain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR005010-PA
Sequence length 928
Comment pep:novel scaffold:Smar1:JH431569:163331:168014:1 gene:SMAR005010 transcript:SMAR005010-RA description:""
Sequence
MSTFFKQPTTVLYKIHAHQWILICLISSITVHCKLEKCTNIWKNALPALDNCTCEQSSNN
ISLIVCKRWSPRPFTFEIRKNDDLNTVKVNGMNSSLPITFIQWFLPVIEPELSHDFKFYS
LVLSNFCNDPSLVMSNHHLNLSRNLFNGRERSLKVLTMSNNCLQSITGSGLYITKLDLSF
NNFTQIPSMDLLKRFKYKLIKFDISNNNINNVSNTDLSIIINLLELNLSNNNLYLLPKDL
LHNLDFLEEIDLSHNYISVLPKEFLKENKQLVKFDISYNNLSELERYAFYYSTELVVINA
SHNKIKSLDLAMTRSDKLKVFNLEMNDIIVLQFDSLPYLKSLKELLLTDNSISKTYQLLA
NPDSNINCNISNNKLATLKIPLTSYILKADVLDMSNNCIENYEVTKYKSSQDITDYKCSN
CCLDTIQSGIFDSVKNKVDISFNNITKLDERTLNTFKNIPNVILSHNKITEVNLTYFEMC
YVNEDKKVEFDLSFNPLMCDCRLNQFIKYLDNQVKPFKFKPKDHLFCSDPAELSGRSLKT
INYDLLCNYPVNCPKSCHCSVDDIDNISLVLIDCSNSNLTHFPNIFSYGSSVIAIQLNLS
HNHIFTLPPKSEPIWKKITILDLSYNRIDSLENMTVAPNLTTLYLNHNSIRGFDYQIVSR
SHLAHLKLAYNPWKCDCEMSKFVEKSSVFEDKHEMSCEKDKILYHFAQVDQICKKFNLLW
LLLPSIIIIIIIFVIIILFIKYKSEIVYYMFSKGICLRFVCEEDIDADKVYDAFVSYSSE
DEDWITDFLVPGLETGTPTYSLCLHNRDWRAGEFITDQIVKSVESSRRTIIVLTDNYLKS
GWSRLEFDIAYQQGLKDKVRRVIAVVPNDVPDLSQIDANFRTFITLTTYIQANKPHFWSK
LRASLPRTKDTLASSNKSVFYLDTQRLL
Download sequence
Identical sequences T1IV21
SMAR005010-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]