SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR005491-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR005491-PA
Domain Number 1 Region: 1012-1145
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.63e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 348-508
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000282
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 835-983
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000118
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 196-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000264
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 588-727
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000541
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 720-877
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000102
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 7 Region: 970-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 1133-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000029
Family EGF-type module 0.0056
Further Details:      
 
Weak hits

Sequence:  SMAR005491-PA
Domain Number - Region: 497-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 311-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 232-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0493
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR005491-PA
Sequence length 1316
Comment pep:novel scaffold:Smar1:JH431612:336117:347085:1 gene:SMAR005491 transcript:SMAR005491-RA description:""
Sequence
MHCSNNFKHFFLLGMIIVNSCHASPRSEQLLKQVRHKNIRSSGVNSLESMFTQCCSLGMS
WVDEKRPCEVAVSPPVSGIPVDLQTPCLVTASICCLRSSRIAMCELGKVDAMDGHECLRS
VLPGGEYRKDCCDSCKIGLMTGSRGESCSFSTFGFEYPWDEGFADCCQISKLSSGGISLP
DVNENNEVQDGRCGANNPCEHLCKDTGHAIECSCQSGYQLEKDGKSCVDIDECVSGFHLC
DHDLQQCVNTEGSYFCLSQDGSRDYPRTRALESGGATFSPAHVPRPLGSSSGTSGGACPI
GYDYNPATRTCDDVNECKLNIDSCDRRTHNCQNTQGSYLCIEQPSPQCAPDINECADGLD
YCNREREYCVNTNGGYECQPKTRSQCPAGYKYNSLLLSCEDINECDEPIPPCKHCINTEG
AYVCGSEQQCPAGYKSGLHGVCEDVNECLENLDDCDKVIDDCINEIGSYRCDAKANGQQK
LCASGYRFDTRQNQCADVNECIENLHTCDVKTHLCINTEGSFRCQRLSVPLVVKTLMNVL
LEPITVQRLMNVKIQWADYLQIAWNRLVRSGTSIGFRNATMPREGTHTCDPEKEVCINKV
GGFVCRALVCPSGYRPNLIARTCVDINECEESNHNCTINQECINRIGGFYCQTIIIRDCP
LGYKFDLLSKSCKDIDECLESLNNCPPSHTCVNIPGNFVCHAICQPGFINDPNDPRQCKD
IDECAEGIDACNRDRETCINSVGSYRCVSHKLDCEAGYQFDSSAGNCVDIDECAESRHNC
YLPSQICVNTQGAFECVSGDIQECSQGYRFDPSSESCIDVNECQTGEQTCTPSQRCDNTI
GSYTCVRTTGCGTGYTLNAQTGNCEDDDECELGLDNCGSLHSCHNNLGSFRCVLKVCPAG
FRLESNGLCLPIVCTTGFEIDATGSCVDINECTQSNICPFSYACVNSIGSYKCEKRNFCG
DGFEVVGTRCVDVDECTRGTHKCRAGQTCVNRQGNYACQCPIGYLMNSRRECEDECARYG
RICTDNGICENTPGSYICRCNSGFTQSGDGKTCIDVDECEASFVCHQKCINTWGSYQCAC
NQGYTLAEDSRTCQDIDECSLWRGRGHLCIGICVNEPGSYTCNCPDGYKLGADKRTCHDI
NECSQPNICRQENEVCLNTRGGYRCNEIVCPANYIRDTEHKTSDDDHDFSVTCHKQCISS
NIACMLNNTNSITRQFTSRPSFPVLNEPLTIVHMKAIVKQSFQNDFYVDIQLEDGIFNYL
FDVISDKEQGSLRLIFPITGPLSIELRIVMRLIVHSNIVASKHLIFVYLDIAKYRF
Download sequence
Identical sequences T1IWC6
SMAR005491-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]