SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR005505-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR005505-PA
Domain Number 1 Region: 933-1060,1267-1426
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.28e-40
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 2 Region: 514-603
Classification Level Classification E-value
Superfamily E set domains 0.00000000000056
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 3 Region: 417-516
Classification Level Classification E-value
Superfamily E set domains 0.00000000000102
Family Other IPT/TIG domains 0.0033
Further Details:      
 
Domain Number 4 Region: 58-109
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000471
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 623-701
Classification Level Classification E-value
Superfamily E set domains 0.0000000532
Family E-set domains of sugar-utilizing enzymes 0.054
Further Details:      
 
Domain Number 6 Region: 725-774
Classification Level Classification E-value
Superfamily E set domains 0.00000322
Family E-set domains of sugar-utilizing enzymes 0.067
Further Details:      
 
Domain Number 7 Region: 12-61
Classification Level Classification E-value
Superfamily Sema domain 0.0000196
Family Sema domain 0.03
Further Details:      
 
Domain Number 8 Region: 374-407
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000929
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  SMAR005505-PA
Domain Number - Region: 207-238
Classification Level Classification E-value
Superfamily Plexin repeat 0.00157
Family Plexin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR005505-PA
Sequence length 1488
Comment pep:novel scaffold:Smar1:JH431612:472596:500142:-1 gene:SMAR005505 transcript:SMAR005505-RA description:""
Sequence
MRVDTMVVIETSRTAYQYSDLEVDRNSPVNADLLFDPNKEFIYVMTERKLTRLKVQECMV
YRSCGECLGAKDPYCGWCSLENKCSLRSECAQASQDPLYWLSYRSGKCTTITNVQPSQIQ
RTTARTLQLTIDNLPNLTGQFVCVFTEPESNKSLHTNATRTALGVSCPTPRTDALPAIPQ
GQHHFTAKLSVKNWTGPEFVATNFTFYDCNTYSSCTQCVSSAFPCDWCVDGHRCTHDTGE
NCRNDILVTGINNIGPSIRSGPGFCPRINSTVVGGSTELLVPYGSVNRVSVKVDNMAQFI
MQTRFVCQFNIDGRVKQVTAQLLGDTIYCENMEFKYNSNSSNLTATFAVIWGGSKPLDNP
DNIHVLVYRCPKMADNCGLCLALPEKYKCGWCQSSDKCQVSDQCDGQGVAWLDRQKTCPN
PRILDFQPRTGPLEGGTKVTIKGINLGRTFEDIQNGVTVAGHQCIPVEDEYIRTAQIVCE
IKTPDLPPENMHKGPVIVKVQDSFRGDSAIPFVYVSPFIQSIKPNKGPQSGGTRLRITGE
HMNAGSTIQAFIDDLPCKITNTSKHHAECITSRSDRRRTGELRMKFDHGERTLQSMKFHY
VDDPKITRVESGPIQSTVIRAIPSGGITIRVHGFHFDAIQEPLVYVTYESQDYISHCHVK
SSTFMQCKSPRIPVDGTIDSDNPRRLDLGFIMDNVTKYRNYNLSLYPNPKYLEFEETKQI
KYYKSDYLTINGENLDLASKESDVKVEIGTRYCNVTSLSSTQLTCRPPTSQPPARGFDGH
PDLNIIPEVVVIVGGDLRYKIGYLSYESPLLPDGTLPNSVIIGVTVGGIILLVIVIAILI
AYRIKSTESNRVLKNMQEQMDVLELRVAAECKEAFAELQTEMTDLTSDLTSGGIPFRDYR
GYAMKNLFPNCDDNSLKELDIDLHRRPTIEKGLKQFGQLIMNKTFLLLFIRTLESNRYFS
MRDRCSVAALIMVALQGKMEYCTDILKTLLAELIEKCIEGKSHPKLLLRRTESVAEKMLS
AWFAFLLYKFLKECAGEPLYLLYRAIKQQVDKGPVDAMTSEARYSLSEEKLIRQSIEYKS
LTVYVSISPQTSYVSGLDSHSESMDLPVKVLDCDTISQVKEKALDSIYKSTPFSQRPSKD
DLDLEWRTGMSGRLILSDEDNTTKTEGEWKKLNTLAHYKVQEGAQLTLVPKQSSMYNLSI
LSEKSEKHNKYETLNFSKLSSASPPLNRATSPLNHNPETGYKKWHLVKHHDSDAHKEGER
GNKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQALQHG
ITDSEVVHTWKSNSLPLRVWVNLIKNPNFVFDIYKSNIVDSCLSVVAVSFMDSCSTSDHR
LGKDSPSSKLLYAKDIPVYKEWVDRYYQDIKLMQAISDQDMNAMLAEESRLHSNEFNTNS
ALYELHGYAVKYNDQLIQQLEEDEFSRKNKLAYKLEHVHSVMAGESDA
Download sequence
Identical sequences T1IWD8
SMAR005505-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]