SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR005543-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR005543-PA
Domain Number 1 Region: 425-570
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-20
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 161-290
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.44e-19
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 255-372
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-18
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 643-713
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.81e-18
Family TB module/8-cys domain 0.00049
Further Details:      
 
Domain Number 5 Region: 366-433
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-16
Family TB module/8-cys domain 0.00038
Further Details:      
 
Domain Number 6 Region: 6-95
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000392
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 7 Region: 799-925
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000518
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 8 Region: 761-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000356
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 9 Region: 716-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000035
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 10 Region: 557-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000396
Family EGF-type module 0.02
Further Details:      
 
Domain Number 11 Region: 603-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000695
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 118-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000137
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 912-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family EGF-type module 0.0053
Further Details:      
 
Weak hits

Sequence:  SMAR005543-PA
Domain Number - Region: 966-997
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0107
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR005543-PA
Sequence length 1186
Comment pep:novel scaffold:Smar1:JH431617:10833:30769:-1 gene:SMAR005543 transcript:SMAR005543-RA description:""
Sequence
MPLPSGKQCVDMRKGYCYSSVFERGPDYYECKNQMPTEQTKMVCCCTVGKGWGSECQPCP
LPGTGERRLLCGDNEDVNECEEKLDVCKNGICMNTIGSFKCECYAGYNYNDLRFSCEDIN
ECVLTPNSCIGIAECINVQGSFRCSCPDGYRLIANNRECQDINECLERPGICDNGECVNL
DGSFQCICREGFYLTPSKDKCLDIDECTRSLHTCRNGTCENLVGSFRCICNPGFSLSPQS
DCIDIDECRTIFGICHNGRCRNTIGSFICECQAGFKFDSTQRNCRDIDECAEGNVCHRGT
CRNMEGGYMCSCGQGYVVSSSGTECYDIDECRENVRLCLFGRCTNTDGSYVCTCPDGFVL
NPYSKECEDQRTGQCYRRFENGRCLEPISNTVTRSTCCCSREAAWGTDICEICPKPSDAT
FRELCPDGYGYVAEIETGMKDINECIIKPGICQNGICINTDGSFRCQCEPGYTLDGSGLR
CVDDDECRSRDICGNGTCRNMIGTFECACFKGYTPGTLQICEDVNECVEQSHLCAFRCLN
VPGSFRCICPYGYTLASDGRHCQDVDECLTQANKCRYECKNLVGSFTCICPVGFQQIGSG
DDCRDINECQLDRNLCKNGRCKNIRGGYRCECFDGYEPSTDGKSCVDTRKAYCFVHLIGG
RCSAQTTNLMLITKVDCCCAMGKAWGPHCEKCPPKDSLDYKQLCPIGEGYREDGQDVDEC
TTMLNLCKNGRCINTLGSYRCMCNRGYKPDYSATHCVDQNECELIPTPCQHLCTNNEGSF
TCSCPIGYVLNADKVTCRDVDECTTQQHHCEQGCVNTPGSFYCSCTTGHKQYGDRCVDVN
ECVDQMCGPTGSCVNTVGSFRCECPRGFTLDSTGSFCIDIDECGSDSQKCQMGCRNTHGS
YRCSCPDGFLQHMNWNHCIDENECMEPEICGSASCQNTAGSYTCTCAPGFQFDTYHYVCI
EAGSSGCHESSCAFGCTADAPGKYTCDCPDGYQRIGEGHCFSTYGPGTSNFAYDYLAGVP
VHPIPDDDDRYTVPDDKIISTEGCYACQLNGRKQKRDLRELQSNFNSESTKKLRHIGYGR
HSNSTSLDYIRIDLELKEAKPKTKLLQLIASMRNMTDVIEYAITKGNWHGLLEMSGKRGV
YTLHFTKVIRKARRFVLEIGSKLIANSTTDKHESLLHTTVVLNLIS
Download sequence
Identical sequences T1IWH6
SMAR005543-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]