SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR006836-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR006836-PA
Domain Number 1 Region: 350-732
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 7.19e-124
Family Oxysterol-binding protein 0.0000149
Further Details:      
 
Domain Number 2 Region: 94-217
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-18
Family Pleckstrin-homology domain (PH domain) 0.00000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR006836-PA
Sequence length 867
Comment pep:novel scaffold:Smar1:JH431728:653494:659831:1 gene:SMAR006836 transcript:SMAR006836-RA description:""
Sequence
MSVGKMEMKTVHSFHSVPDSNGGSPIEGEGHYEEGFFRQYDSPSSTPKAESLKGFASDLS
MSKLTKRESYKAQRKNYRREKKRVAEELMSTLRDSSIIVIADWVKIRGTLKGWTKLWCVV
KPGLMLLYKGPKIHKSSYWVGTVMLNVCELIERPSKKDGFCFKLFHPLEQSIWASRGPSG
ETIGAVVQPLPTAYLIFRAPSEVAGKCWMEALQLTLRCPTSLTGRQKESVPALPTKPSAE
LSSPVLNREETPTTPTYLEEDGPQTQWNESDYERHFNEHDLEDDLHTDDNREIDPDGVHS
LRSSDSDSDGHYKDEPELLEDEEPNETSYVENESEEFGLVGDAGQTEEFADENKSLIWSV
VKQVRPGMDLSKVVLPTFILEPRSFLDKLTDYYYHADILSRAVLEDDPFTRMKMVVQWYM
SGFYKKPRGLKKPYNPILGETFRCNWKHPETNSRTFYIAEQVSHHPPVSAFYVTNRKDGF
CIRGSILAKSKFYGNSLSAILDGKARLSFLTRGEDYTMTMPYAHCKGILLGTLTMELGGK
IQIDCEKTGYKTDIEFKLKPFFGGYILSNSISGRIRLGKETLANVEGHWDQEIRCVDKRT
GEQSLLWSPTPEIRTKRLVRYTVPLESQTEVESEKLWIHVSAAISQGNQVAATEEKRILE
EAQRQRAKERKVKCVEWFARYFEQDLISGEWVYKNADSRPWDPRNDVHQYECDYIIRTKT
RHRTPIIRTSSIVSVDDLVPVDCLMGRGPRITKQTSINHRRLRDRGDSESSTQEAECVHA
SDSSDSERLSSKPATEVQLDSASFTELLKPIQAAQEKQTEQLKLLRGSVDHLLQNERRRG
EHVQRIDWLMITAVLLVQMLINFVMRS
Download sequence
Identical sequences T1IZZ7
SMAR006836-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]