SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR008035-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR008035-PA
Domain Number 1 Region: 33-251
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-51
Family Nuclear receptor ligand-binding domain 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SMAR008035-PA
Sequence length 288
Comment pep:novel scaffold:Smar1:JH431820:315512:316577:1 gene:SMAR008035 transcript:SMAR008035-RA description:""
Sequence
MKVETVQNTRDCITHRRHNHNHEAPTNSSGISIDILLNAEKTDIDCNEKIHETGNKKDAT
LDDVSYSMNIELKKQVKWAKKIPAFTNLPINDKTTLLKAHAGESLLVGVCHRSWHLNDVL
LLGNNHQILRQNKEIEMNLISNRIMDELIQPLKEIQMDDTEFACLKAIIVLDPTSKELEN
IAAVKELRSQVQLILEDYINRQHSPRGRFGQILLMLPVLQSISWQMIGVVQRANTIGITK
IDDFLREVLLGGIRHCLCSKKYSEIPQIFLLNFSNCNSFVTDESFQIE
Download sequence
Identical sequences T1J375
SMAR008035-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]