SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR008311-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR008311-PA
Domain Number 1 Region: 229-395
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.66e-39
Family Dual specificity phosphatase-like 0.0000244
Further Details:      
 
Domain Number 2 Region: 423-538
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.81e-18
Family PLC-like (P variant) 0.0036
Further Details:      
 
Domain Number 3 Region: 103-189
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000738
Family Voltage-gated potassium channels 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR008311-PA
Sequence length 554
Comment pep:novel scaffold:Smar1:JH431832:315047:318026:1 gene:SMAR008311 transcript:SMAR008311-RA description:""
Sequence
MPIVKAHTKPTYKRFDTYVTPDFTDDLEKNNWNDNSVAIDVMGSKEKKDETDDEDDIDED
IEDPFSYDAHALHNTIDPVAVAEPLPTTCFGKFRLKLENVVEHFIFRLFGLILIVIDICI
LIVELVKIQDDNLEEQKPYEIVSLTFVCYFVLEVTLRIIALGANRFFRQWFNVIDFIVVF
TAFIITLISAVIDLIDLSGIYKLFTAKKHVEKGARHMVSQNKRRYQEDGFDLDLTYVTDR
VIAMSFPSAGKMSCYRNPIKEVARFFNTKHPDHYKVYNLCSERTYDDQYFHGRVERYLVD
DHNVPLLEDMVRFARSVRTWLDSHPLNVIAVHCKGGKGRTGTMICIWLVESGLFESAGDS
LDYFGFRRTDLNISNKFQGVETPSQSRYVGYYEDIKDKLNGQMPEERALKIKMLRITALA
GLGKGDGSDFSCEIFIGRNNKIFECNFGLNKNCQTHYYNEADYLEVKLTNCPNLVGDVKM
KEIFLEDMKKLPFYLWFYTSFIENGSLLIKRNDLDNPHKPKTWQWFREKFSIEIIFETTI
NEENVGNCQKQMDP
Download sequence
Identical sequences T1J3Y5
SMAR008311-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]