SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SMAR011767-PA from Strigamia maritima 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SMAR011767-PA
Domain Number 1 Region: 152-326
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.11e-32
Family Nuclear receptor ligand-binding domain 0.0000094
Further Details:      
 
Domain Number 2 Region: 31-114
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.2e-30
Family Nuclear receptor 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SMAR011767-PA
Sequence length 327
Comment pep:novel scaffold:Smar1:JH432100:179200:185855:-1 gene:SMAR011767 transcript:SMAR011767-RA description:""
Sequence
MSPPGSINGFPVDSFGESKKKKGPTPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRS
ITKNAVYQCKYGNNCEIDMYMRRKCQECRLKKCLNVGMRPECVVPEQQCAVKREAKRQQK
EKDKPNSTTKEHGSPVDLHKEETKEKDPAMANKLSSEEAELIERLVYFQEEFESPSDDDL
KKITQFPFTGQDVSDDDRRFKHITEITILTVQLIVEFAKCVPGFIPLKREDQITLLKTFP
FTGEDGEKRPQLLEPKKVEKIQEIYLEALRKYVDNHRTKSVNMFARLLSVLTELRTLGNL
NSEMCFSLKLSNKKLPPFLAEIWDIQC
Download sequence
Identical sequences T1JD91
SMAR011767-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]